TOMMY IO
DEMO MODE
S-01 · Operate
Dashboard
Terminal metric: 4 executed LOIs across 18,680 SF. Everything on this screen rolls up to that number.
4 / 4
Spaces still available
0
LOI / Leased (terminal)
$74,064
Spend · 30d (demo)
65
One-click leads · 30d

Site Plan — Command Surface

signature
14903 BUILDING — IN-LINESUITE 4001,400 SF · AVAILABLESUITE 5002,100 SF · AVAILABLESUITE 6005,180 SF · AVAILABLE100 · PIZZA2,850 SF · COMMITTED200 · AT&T1,400 SF · COMMITTED300 · NAILS2,100 SF · COMMITTED7002,100 SF · COMMITTED8001,250 SF · COMMITTED14901 — STANDALONE SOUTH BUILDING14901 SOUTH BLDG10,000 SF · AVAILABLEU.S. HIGHWAY 169 FRONTAGE →Click a suite to change status. LOI or LEASED auto-flags every campaign targeting it for pause.
AvailableLOI pendingLeasedCommitted pre-launch

Funnel · impressions by stage (30d)

226,38000 UNAWARE
130,74701 PROBLEM
002 SOLUTION
153,18403 PRODUCT
76,58804 CONVERSION
CTR
0.65%
VCR (completions/starts)
31.0%
CPL
$1,139

Due now — scheduled actions

LAUNCHLaunch Document Ad (flyer) — Segment F
LAUNCHPublish + sponsor Thought Leader posts (Danner, Nelson)

Pipeline by contact status

2
ENGAGED
1
PACKAGE SENT
1
TOUR REQUESTED
0
TOUR HELD
0
LOI
S-13 · Operate
Action Feed — Autopilot + Human in the Loop
Every action the system wants to take — API calls, audience moves, scheduled content, optimizations, tests, growth plays — queued on a clock. If nobody touches a card, it fires at T-0 (autopilot). Humans can run early, edit the payload, snooze, or kill it. Approval-class cards (spend, outreach, stage moves) never fire on their own.
system clock
18:07:44
next to fire
—
11 queued0 awaiting human1 done
00:21
Adopt engagement score: Dana R. (93)
04:21
Signal outreach: Dana R. · lease expiring
05:21
Launch headline B-test on cr-A-img
NURTURE00:21
Adopt engagement score: Dana R. (93)
Server-side stream says 93; CRM score says 35. Adopt + route to broker (score ≥ 25 SLA: 1 business hour).
approval-class — never auto-runs (spend / outreach / stage move)
fn: adoptEngFeed(ct-isj17r)
NURTURE04:21
Signal outreach: Dana R. · lease expiring
Merged lease-expiry call script queued from the Outreach tab. Logs to the tracking stream on use.
approval-class — never auto-runs (spend / outreach / stage move)
fn: outreachFeed(ct-isj17r, as-lease)
A/B TEST05:21
Launch headline B-test on cr-A-img
Duplicate the A/03 stat card with the corridor-gap headline. creativeSelection OPTIMIZED rotates it in; 7-day read on CTR.
fn: testVariant(cr-A-img)
GROWTH16:21
Counter-creative gap: segment A
Gallery shows competitor pressure at A with no counter drafted. One click drafts the sourced-number answer.
fn: draftCounterFeed(A)
API CALL26:21
Activate SMV|A|00-UNAWARE|VID
PATCH status DRAFT → ACTIVE. Spend begins — held for human approval.
approval-class — never auto-runs (spend / outreach / stage move)
payload · POST /rest/adAccounts/{AD_ACCOUNT_ID}/adCampaigns/{CID}?xmethod=PARTIAL_UPDATE — editable
GROWTH36:21
Counter-creative gap: segment B
Gallery shows competitor pressure at B with no counter drafted. One click drafts the sourced-number answer.
fn: draftCounterFeed(B)
API CALL41:21
Activate SMV|A|03-PRODUCT|VID
PATCH status DRAFT → ACTIVE. Spend begins — held for human approval.
approval-class — never auto-runs (spend / outreach / stage move)
payload · POST /rest/adAccounts/{AD_ACCOUNT_ID}/adCampaigns/{CID}?xmethod=PARTIAL_UPDATE — editable
OPTIMIZE41:21
Budget shift: worst CTR → A/03
Move 10% of daily from the flight’s lowest-CTR campaign into A/03 (top demo CTR). PATCH dailyBudget both sides.
approval-class — never auto-runs (spend / outreach / stage move)
payload · POST /rest/adAccounts/{AD_ACCOUNT_ID}/adCampaigns/{CID}?xmethod=PARTIAL_UPDATE — editable
GROWTH56:21
Counter-creative gap: segment C
Gallery shows competitor pressure at C with no counter drafted. One click drafts the sourced-number answer.
fn: draftCounterFeed(C)
OPTIMIZE01:26:21
Fatigue guard: pause cr-ALL-car if freq > 4
Carousel is first to burn. If MEMBER frequency exceeds 4.0 this flight, PATCH intendedStatus → PAUSED and rotate the B set in.
fn: pauseCreative(cr-ALL-car)
CONTENT14:52:15
Tomorrow 9:00 — Nelson TLA boost window
Thought-leader ad renews reach on B. Nelson’s corridor post. Requires member approval already on file.
fn: noteOnly(TLA boost window opened — confirm budget in S-02)
API CALLDONE · AUTO 18:06
Weekly audience floor check · SEG A cold
Preflight audienceCounts before spend: floor 300, healthy 50K+. Fails loud if the boolean rules drifted.
payload · GET /rest/adAccounts/{AD_ACCOUNT_ID}/audienceCounts?q=targetingCriteriaV2 — editable
Sources: calendar → CONTENT · campaign state → API CALL · contact status vs DMP tags → AUDIENCE · demo analytics + fatigue rules → OPTIMIZE · creative library → A/B TEST · competitor gallery gaps → GROWTH · engagement scores → NURTURE. Regenerate anytime — the queue rebuilds from whatever is true right now.
S-02 · Operate
Campaign Architecture
One campaign group per property, one campaign per segment × stage. Every card shows the exact adCampaigns payload; Send posts it (or simulates in demo).

Campaign Group

not created
{"account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "name": "SMV | Shops at Smithville | Pre-Leasing 2026", "status": "DRAFT", "runSchedule": {"start": 1784595845543}, "totalBudget": {"amount": "15000", "currencyCode": "USD"}}
SEGMENT A — Medical / Dental / Urgent Care5 campaignsest 18K–25K (KC metro)
Targets suites: 400, 500, 600 · Healthcare Services function + Hospital & Health Care industry
SMV|A|00-UNAWARE|VIDDRAFTVIDEO_VIEW
{"name": "SMV|A|00-UNAWARE|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:jobFunctions": [ "{RESOLVE:function:Healthcare Services}" ]}},{"or": {"urn:li:adTargetingFacet:staffCountRanges": [ "urn:li:staffCountRange:(2,10)", "urn:li:staffCountRange:(11,50)", "urn:li:staffCountRange:(51,200)" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|A|01-PROBLEM|VIDDRAFTVIDEO_VIEW
{"name": "SMV|A|01-PROBLEM|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:jobFunctions": [ "{RESOLVE:function:Healthcare Services}" ]}},{"or": {"urn:li:adTargetingFacet:staffCountRanges": [ "urn:li:staffCountRange:(2,10)", "urn:li:staffCountRange:(11,50)", "urn:li:staffCountRange:(51,200)" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|A|02-SOLUTION|VIDDRAFTVIDEO_VIEW
{"name": "SMV|A|02-SOLUTION|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:jobFunctions": [ "{RESOLVE:function:Healthcare Services}" ]}},{"or": {"urn:li:adTargetingFacet:staffCountRanges": [ "urn:li:staffCountRange:(2,10)", "urn:li:staffCountRange:(11,50)", "urn:li:staffCountRange:(51,200)" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|A|03-PRODUCT|VIDDRAFTVIDEO_VIEW
{"name": "SMV|A|03-PRODUCT|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:jobFunctions": [ "{RESOLVE:function:Healthcare Services}" ]}},{"or": {"urn:li:adTargetingFacet:staffCountRanges": [ "urn:li:staffCountRange:(2,10)", "urn:li:staffCountRange:(11,50)", "urn:li:staffCountRange:(51,200)" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|A|04-CONVERSION|LGFDRAFTLEAD_GENERATION
{"name": "SMV|A|04-CONVERSION|LGF", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "STANDARD_UPDATE", "objectiveType": "LEAD_GENERATION", "optimizationTargetType": "MAX_LEAD", "costType": "CPM", "dailyBudget": {"amount": "40", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:jobFunctions": [ "{RESOLVE:function:Healthcare Services}" ]}},{"or": {"urn:li:adTargetingFacet:staffCountRanges": [ "urn:li:staffCountRange:(2,10)", "urn:li:staffCountRange:(11,50)", "urn:li:staffCountRange:(51,200)" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SEGMENT B — Franchise QSR & Coffee Developers5 campaignsest 9K–14K
Targets suites: 14901 · BD/Real Estate function + Restaurants industry + Site Selection skill
SMV|B|00-UNAWARE|VIDDRAFTVIDEO_VIEW
{"name": "SMV|B|00-UNAWARE|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Restaurants}" ]}},{"or": {"urn:li:adTargetingFacet:skills": [ "{RESOLVE:skill:Site Selection}", "{RESOLVE:skill:Franchise Development}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|B|01-PROBLEM|VIDDRAFTVIDEO_VIEW
{"name": "SMV|B|01-PROBLEM|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Restaurants}" ]}},{"or": {"urn:li:adTargetingFacet:skills": [ "{RESOLVE:skill:Site Selection}", "{RESOLVE:skill:Franchise Development}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|B|02-SOLUTION|VIDDRAFTVIDEO_VIEW
{"name": "SMV|B|02-SOLUTION|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Restaurants}" ]}},{"or": {"urn:li:adTargetingFacet:skills": [ "{RESOLVE:skill:Site Selection}", "{RESOLVE:skill:Franchise Development}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|B|03-PRODUCT|VIDDRAFTVIDEO_VIEW
{"name": "SMV|B|03-PRODUCT|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Restaurants}" ]}},{"or": {"urn:li:adTargetingFacet:skills": [ "{RESOLVE:skill:Site Selection}", "{RESOLVE:skill:Franchise Development}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|B|04-CONVERSION|LGFDRAFTLEAD_GENERATION
{"name": "SMV|B|04-CONVERSION|LGF", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "STANDARD_UPDATE", "objectiveType": "LEAD_GENERATION", "optimizationTargetType": "MAX_LEAD", "costType": "CPM", "dailyBudget": {"amount": "40", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Restaurants}" ]}},{"or": {"urn:li:adTargetingFacet:skills": [ "{RESOLVE:skill:Site Selection}", "{RESOLVE:skill:Franchise Development}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SEGMENT C — Fitness Franchisees & Area Developers5 campaignsest 7K–11K
Targets suites: 14901 · Health, Wellness & Fitness industry + Franchise Development skill
SMV|C|00-UNAWARE|VIDDRAFTVIDEO_VIEW
{"name": "SMV|C|00-UNAWARE|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Health, Wellness & Fitness}" ]}},{"or": {"urn:li:adTargetingFacet:skills": [ "{RESOLVE:skill:Franchising}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|C|01-PROBLEM|VIDDRAFTVIDEO_VIEW
{"name": "SMV|C|01-PROBLEM|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Health, Wellness & Fitness}" ]}},{"or": {"urn:li:adTargetingFacet:skills": [ "{RESOLVE:skill:Franchising}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|C|02-SOLUTION|VIDDRAFTVIDEO_VIEW
{"name": "SMV|C|02-SOLUTION|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Health, Wellness & Fitness}" ]}},{"or": {"urn:li:adTargetingFacet:skills": [ "{RESOLVE:skill:Franchising}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|C|03-PRODUCT|VIDDRAFTVIDEO_VIEW
{"name": "SMV|C|03-PRODUCT|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Health, Wellness & Fitness}" ]}},{"or": {"urn:li:adTargetingFacet:skills": [ "{RESOLVE:skill:Franchising}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|C|04-CONVERSION|LGFDRAFTLEAD_GENERATION
{"name": "SMV|C|04-CONVERSION|LGF", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "STANDARD_UPDATE", "objectiveType": "LEAD_GENERATION", "optimizationTargetType": "MAX_LEAD", "costType": "CPM", "dailyBudget": {"amount": "40", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Health, Wellness & Fitness}" ]}},{"or": {"urn:li:adTargetingFacet:skills": [ "{RESOLVE:skill:Franchising}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SEGMENT D — Regional Restaurant Groups5 campaignsest 8K–12K
Targets suites: 600 · Restaurants industry + Owner/Partner seniority
SMV|D|00-UNAWARE|VIDDRAFTVIDEO_VIEW
{"name": "SMV|D|00-UNAWARE|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Restaurants}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}", "{RESOLVE:seniority:Partner}", "{RESOLVE:seniority:Director}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|D|01-PROBLEM|VIDDRAFTVIDEO_VIEW
{"name": "SMV|D|01-PROBLEM|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Restaurants}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}", "{RESOLVE:seniority:Partner}", "{RESOLVE:seniority:Director}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|D|02-SOLUTION|VIDDRAFTVIDEO_VIEW
{"name": "SMV|D|02-SOLUTION|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Restaurants}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}", "{RESOLVE:seniority:Partner}", "{RESOLVE:seniority:Director}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|D|03-PRODUCT|VIDDRAFTVIDEO_VIEW
{"name": "SMV|D|03-PRODUCT|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Restaurants}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}", "{RESOLVE:seniority:Partner}", "{RESOLVE:seniority:Director}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|D|04-CONVERSION|LGFDRAFTLEAD_GENERATION
{"name": "SMV|D|04-CONVERSION|LGF", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "STANDARD_UPDATE", "objectiveType": "LEAD_GENERATION", "optimizationTargetType": "MAX_LEAD", "costType": "CPM", "dailyBudget": {"amount": "40", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Restaurants}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}", "{RESOLVE:seniority:Partner}", "{RESOLVE:seniority:Director}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SEGMENT E — Professional Services5 campaignsest 30K–45K
Targets suites: 400 · Financial Services / Insurance / Legal industries
SMV|E|00-UNAWARE|VIDDRAFTVIDEO_VIEW
{"name": "SMV|E|00-UNAWARE|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Financial Services}", "{RESOLVE:industry:Insurance}", "{RESOLVE:industry:Law Practice}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}", "{RESOLVE:seniority:Partner}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|E|01-PROBLEM|VIDDRAFTVIDEO_VIEW
{"name": "SMV|E|01-PROBLEM|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Financial Services}", "{RESOLVE:industry:Insurance}", "{RESOLVE:industry:Law Practice}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}", "{RESOLVE:seniority:Partner}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|E|02-SOLUTION|VIDDRAFTVIDEO_VIEW
{"name": "SMV|E|02-SOLUTION|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Financial Services}", "{RESOLVE:industry:Insurance}", "{RESOLVE:industry:Law Practice}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}", "{RESOLVE:seniority:Partner}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|E|03-PRODUCT|VIDDRAFTVIDEO_VIEW
{"name": "SMV|E|03-PRODUCT|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Financial Services}", "{RESOLVE:industry:Insurance}", "{RESOLVE:industry:Law Practice}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}", "{RESOLVE:seniority:Partner}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|E|04-CONVERSION|LGFDRAFTLEAD_GENERATION
{"name": "SMV|E|04-CONVERSION|LGF", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "STANDARD_UPDATE", "objectiveType": "LEAD_GENERATION", "optimizationTargetType": "MAX_LEAD", "costType": "CPM", "dailyBudget": {"amount": "40", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Financial Services}", "{RESOLVE:industry:Insurance}", "{RESOLVE:industry:Law Practice}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}", "{RESOLVE:seniority:Partner}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SEGMENT F — Tenant-Rep Brokers & Site Selectors3 campaignsest 12K–18K
Targets suites: 400, 500, 600, 14901 · Tenant Representation + Site Selection skills, CCIM/SIOR groups
SMV|F|02-SOLUTION|VIDDRAFTVIDEO_VIEW
{"name": "SMV|F|02-SOLUTION|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:skills": [ "{RESOLVE:skill:Tenant Representation}", "{RESOLVE:skill:Site Selection}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Real Estate}", "{RESOLVE:industry:Commercial Real Estate}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|F|03-PRODUCT|VIDDRAFTVIDEO_VIEW
{"name": "SMV|F|03-PRODUCT|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:skills": [ "{RESOLVE:skill:Tenant Representation}", "{RESOLVE:skill:Site Selection}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Real Estate}", "{RESOLVE:industry:Commercial Real Estate}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|F|04-CONVERSION|LGFDRAFTLEAD_GENERATION
{"name": "SMV|F|04-CONVERSION|LGF", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "STANDARD_UPDATE", "objectiveType": "LEAD_GENERATION", "optimizationTargetType": "MAX_LEAD", "costType": "CPM", "dailyBudget": {"amount": "40", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:skills": [ "{RESOLVE:skill:Tenant Representation}", "{RESOLVE:skill:Site Selection}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Real Estate}", "{RESOLVE:industry:Commercial Real Estate}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SEGMENT G — Retail / Specialty (Pet, Vet, Liquor)5 campaignsest 10K–15K
Targets suites: 500, 600 · Retail + Veterinary industries
SMV|G|00-UNAWARE|VIDDRAFTVIDEO_VIEW
{"name": "SMV|G|00-UNAWARE|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Retail}", "{RESOLVE:industry:Veterinary}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|G|01-PROBLEM|VIDDRAFTVIDEO_VIEW
{"name": "SMV|G|01-PROBLEM|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Retail}", "{RESOLVE:industry:Veterinary}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|G|02-SOLUTION|VIDDRAFTVIDEO_VIEW
{"name": "SMV|G|02-SOLUTION|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Retail}", "{RESOLVE:industry:Veterinary}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|G|03-PRODUCT|VIDDRAFTVIDEO_VIEW
{"name": "SMV|G|03-PRODUCT|VID", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "SINGLE_VIDEO", "objectiveType": "VIDEO_VIEW", "optimizationTargetType": "MAX_VIDEO_VIEW", "costType": "CPV", "dailyBudget": {"amount": "25", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Retail}", "{RESOLVE:industry:Veterinary}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
SMV|G|04-CONVERSION|LGFDRAFTLEAD_GENERATION
{"name": "SMV|G|04-CONVERSION|LGF", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "campaignGroup": "urn:li:sponsoredCampaignGroup:{CG_ID}", "type": "SPONSORED_UPDATES", "format": "STANDARD_UPDATE", "objectiveType": "LEAD_GENERATION", "optimizationTargetType": "MAX_LEAD", "costType": "CPM", "dailyBudget": {"amount": "40", "currencyCode": "USD"}, "unitCost": {"amount": "0", "currencyCode": "USD"}, "creativeSelection": "OPTIMIZED", "audienceExpansionEnabled": false, "offsiteDeliveryEnabled": false, "locale": {"country": "US", "language": "en"}, "runSchedule": {"start": 1784595845543}, "status": "DRAFT", "targetingCriteria": {"include": {"and": [{"or": {"urn:li:adTargetingFacet:locations": [ "{RESOLVE:geo:Kansas City Metropolitan Area}" ]}},{"or": {"urn:li:adTargetingFacet:industries": [ "{RESOLVE:industry:Retail}", "{RESOLVE:industry:Veterinary}" ]}},{"or": {"urn:li:adTargetingFacet:seniorities": [ "{RESOLVE:seniority:Owner}" ]}}]}, "exclude": {"or": {"urn:li:adTargetingFacet:employers": [ "{RESOLVE:employer:Windfield Real Estate}" ]}}}}
S-03 · Operate
Creative Studio
Templates enforce LinkedIn’s hard character limits and compile straight to the createInline payload with a dark post (feedDistribution: NONE). Media uploads run through initializeUpload; drop the returned URN into the payload.
Dark post = the ad exists as a urn:li:ugcPost that never appears on the Windfield Page feed. Thought Leader creatives instead reference a member’s organic post and require that member’s approval in Campaign Manager → Partnerships.
cr-F-doc · DOCUMENT · seg F · stage 03DRAFT
150 / 600
65 / 200
media: 5-page flyer PDF → /rest/documents initializeUpload → urn:li:document:{id}
cr-A-img · SINGLE_IMAGE · seg A · stage 03DRAFT
149 / 600 (rec 150)
60 / 200 (rec 70)
87 / 300
media: Exterior hero (flyer p.1) + green suite overlay → urn:li:image:{id}
cr-B-img · SINGLE_IMAGE · seg B · stage 03DRAFT
134 / 600 (rec 150)
56 / 200 (rec 70)
95 / 300
media: Location map (flyer p.3) with co-tenancy pins
cr-E-img · SINGLE_IMAGE · seg E · stage 03DRAFT
138 / 600 (rec 150)
59 / 200 (rec 70)
86 / 300
media: Suites 100-800 exterior (flyer p.2)
cr-ALL-car · CAROUSEL · seg ALL · stage 03DRAFT
171 / 255
34 / 45
26 / 45
35 / 45
37 / 45
33 / 45
30 / 45
cr-TLA-nelson · THOUGHT_LEADER · seg F · stage 02DRAFT
519 / 3000
media: Sponsors Ben Nelson’s ORGANIC member post — requires his approval in Campaign Manager (Partnerships). Objective must be BRAND_AWARENESS or ENGAGEMENT.
cr-A-conv · CONVERSATION · seg A · stage 04DRAFT
22 / 25
20 / 25
22 / 25
22 / 25
19 / 25
216 / 500
Sponsored Messaging — exclude EU geography (unavailable to EU members).
S-04 · Operate
Targeting Builder
Edits targetingCriteria per campaign, validates LinkedIn’s boolean rules, resolves URNs via adTargetingEntities typeahead, and preflights audienceCounts. {RESOLVE:} tokens block sending until replaced.

URN Resolver — adTargetingEntities typeahead

Live mode returns real URNs to paste over the {RESOLVE:} tokens below. Demo mode shows the request only.

Rules the builder enforces

• titles cannot be AND’ed with seniorities or jobFunctions (include).
• employers cannot be AND’ed with industries or staffCountRanges (include).
• 300 members = absolute serve floor; recommended 50,000+ (Sponsored Content 300,000). Preflight before create.
• ageRanges / genders / groups are include-only.
SMV|A|00-UNAWARE|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:function:Healthcare Services}, {RESOLVE:employer:Windfield Real Estate}
SMV|A|01-PROBLEM|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:function:Healthcare Services}, {RESOLVE:employer:Windfield Real Estate}
SMV|A|02-SOLUTION|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:function:Healthcare Services}, {RESOLVE:employer:Windfield Real Estate}
SMV|A|03-PRODUCT|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:function:Healthcare Services}, {RESOLVE:employer:Windfield Real Estate}
SMV|A|04-CONVERSION|LGFrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:function:Healthcare Services}, {RESOLVE:employer:Windfield Real Estate}
SMV|B|00-UNAWARE|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Restaurants}, {RESOLVE:skill:Site Selection}, {RESOLVE:skill:Franchise Development}, {RESOLVE:employer:Windfield Real Estate}
SMV|B|01-PROBLEM|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Restaurants}, {RESOLVE:skill:Site Selection}, {RESOLVE:skill:Franchise Development}, {RESOLVE:employer:Windfield Real Estate}
SMV|B|02-SOLUTION|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Restaurants}, {RESOLVE:skill:Site Selection}, {RESOLVE:skill:Franchise Development}, {RESOLVE:employer:Windfield Real Estate}
SMV|B|03-PRODUCT|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Restaurants}, {RESOLVE:skill:Site Selection}, {RESOLVE:skill:Franchise Development}, {RESOLVE:employer:Windfield Real Estate}
SMV|B|04-CONVERSION|LGFrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Restaurants}, {RESOLVE:skill:Site Selection}, {RESOLVE:skill:Franchise Development}, {RESOLVE:employer:Windfield Real Estate}
SMV|C|00-UNAWARE|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Health, Wellness & Fitness}, {RESOLVE:skill:Franchising}, {RESOLVE:employer:Windfield Real Estate}
SMV|C|01-PROBLEM|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Health, Wellness & Fitness}, {RESOLVE:skill:Franchising}, {RESOLVE:employer:Windfield Real Estate}
SMV|C|02-SOLUTION|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Health, Wellness & Fitness}, {RESOLVE:skill:Franchising}, {RESOLVE:employer:Windfield Real Estate}
SMV|C|03-PRODUCT|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Health, Wellness & Fitness}, {RESOLVE:skill:Franchising}, {RESOLVE:employer:Windfield Real Estate}
SMV|C|04-CONVERSION|LGFrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Health, Wellness & Fitness}, {RESOLVE:skill:Franchising}, {RESOLVE:employer:Windfield Real Estate}
SMV|D|00-UNAWARE|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Restaurants}, {RESOLVE:seniority:Owner}, {RESOLVE:seniority:Partner}, {RESOLVE:seniority:Director}, {RESOLVE:employer:Windfield Real Estate}
SMV|D|01-PROBLEM|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Restaurants}, {RESOLVE:seniority:Owner}, {RESOLVE:seniority:Partner}, {RESOLVE:seniority:Director}, {RESOLVE:employer:Windfield Real Estate}
SMV|D|02-SOLUTION|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Restaurants}, {RESOLVE:seniority:Owner}, {RESOLVE:seniority:Partner}, {RESOLVE:seniority:Director}, {RESOLVE:employer:Windfield Real Estate}
SMV|D|03-PRODUCT|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Restaurants}, {RESOLVE:seniority:Owner}, {RESOLVE:seniority:Partner}, {RESOLVE:seniority:Director}, {RESOLVE:employer:Windfield Real Estate}
SMV|D|04-CONVERSION|LGFrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Restaurants}, {RESOLVE:seniority:Owner}, {RESOLVE:seniority:Partner}, {RESOLVE:seniority:Director}, {RESOLVE:employer:Windfield Real Estate}
SMV|E|00-UNAWARE|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Financial Services}, {RESOLVE:industry:Insurance}, {RESOLVE:industry:Law Practice}, {RESOLVE:seniority:Owner}, {RESOLVE:seniority:Partner}, {RESOLVE:employer:Windfield Real Estate}
SMV|E|01-PROBLEM|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Financial Services}, {RESOLVE:industry:Insurance}, {RESOLVE:industry:Law Practice}, {RESOLVE:seniority:Owner}, {RESOLVE:seniority:Partner}, {RESOLVE:employer:Windfield Real Estate}
SMV|E|02-SOLUTION|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Financial Services}, {RESOLVE:industry:Insurance}, {RESOLVE:industry:Law Practice}, {RESOLVE:seniority:Owner}, {RESOLVE:seniority:Partner}, {RESOLVE:employer:Windfield Real Estate}
SMV|E|03-PRODUCT|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Financial Services}, {RESOLVE:industry:Insurance}, {RESOLVE:industry:Law Practice}, {RESOLVE:seniority:Owner}, {RESOLVE:seniority:Partner}, {RESOLVE:employer:Windfield Real Estate}
SMV|E|04-CONVERSION|LGFrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Financial Services}, {RESOLVE:industry:Insurance}, {RESOLVE:industry:Law Practice}, {RESOLVE:seniority:Owner}, {RESOLVE:seniority:Partner}, {RESOLVE:employer:Windfield Real Estate}
SMV|F|02-SOLUTION|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:skill:Tenant Representation}, {RESOLVE:skill:Site Selection}, {RESOLVE:industry:Real Estate}, {RESOLVE:industry:Commercial Real Estate}, {RESOLVE:employer:Windfield Real Estate}
SMV|F|03-PRODUCT|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:skill:Tenant Representation}, {RESOLVE:skill:Site Selection}, {RESOLVE:industry:Real Estate}, {RESOLVE:industry:Commercial Real Estate}, {RESOLVE:employer:Windfield Real Estate}
SMV|F|04-CONVERSION|LGFrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:skill:Tenant Representation}, {RESOLVE:skill:Site Selection}, {RESOLVE:industry:Real Estate}, {RESOLVE:industry:Commercial Real Estate}, {RESOLVE:employer:Windfield Real Estate}
SMV|G|00-UNAWARE|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Retail}, {RESOLVE:industry:Veterinary}, {RESOLVE:seniority:Owner}, {RESOLVE:employer:Windfield Real Estate}
SMV|G|01-PROBLEM|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Retail}, {RESOLVE:industry:Veterinary}, {RESOLVE:seniority:Owner}, {RESOLVE:employer:Windfield Real Estate}
SMV|G|02-SOLUTION|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Retail}, {RESOLVE:industry:Veterinary}, {RESOLVE:seniority:Owner}, {RESOLVE:employer:Windfield Real Estate}
SMV|G|03-PRODUCT|VIDrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Retail}, {RESOLVE:industry:Veterinary}, {RESOLVE:seniority:Owner}, {RESOLVE:employer:Windfield Real Estate}
SMV|G|04-CONVERSION|LGFrules ok1 warn
Unresolved URNs (resolve via typeahead before send): {RESOLVE:geo:Kansas City Metropolitan Area}, {RESOLVE:industry:Retail}, {RESOLVE:industry:Veterinary}, {RESOLVE:seniority:Owner}, {RESOLVE:employer:Windfield Real Estate}
S-05 · Operate
Audiences — DMP Segments
Matched lists, website retargeting, engagement retargeting (video quartiles FIRST_QUARTILE / MIDPOINT / THIRD_QUARTILE / FULL_COMPLETE), and journey-stage streaming: ADD to the next stage, REMOVE from the last, in one batch.
SMV_ALL_SITE_RETARGET_90DWEBSITEnot created
Insight Tag page-set: /smithville/*, 90-day lookback
{"name": "SMV_ALL_SITE_RETARGET_90D", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "type": "USER", "sourcePlatform": "AD_PAGE_SET", "destinations": [{"destination": "LINKEDIN"}]}
SMV_A_VID_MIDPOINT_90DENGAGEMENTnot created
≥50% video viewers, Segment A creatives · trigger MIDPOINT · 90d lookback
{"name": "SMV_A_VID_MIDPOINT_90D", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "type": "USER", "sourcePlatform": "VIDEO_ADS", "destinations": [{"destination": "LINKEDIN"}]}
SMV_ALL_LGF_OPEN_90DENGAGEMENTnot created
Opened any lead form · trigger VIEW_FORM · 90d lookback
{"name": "SMV_ALL_LGF_OPEN_90D", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "type": "USER", "sourcePlatform": "LEAD_GEN_FORMS", "destinations": [{"destination": "LINKEDIN"}]}
SMV_F_BROKERAGE_ABMLISTnot created
Named KC brokerages CSV
{"name": "SMV_F_BROKERAGE_ABM", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "type": "COMPANY_LIST_UPLOAD", "sourcePlatform": "LIST_UPLOAD", "destinations": [{"destination": "LINKEDIN"}]}
SMV_STAGE_TOUR_READYLISTnot created
Journey tag: tour-ready (streamed ADD/REMOVE)
{"name": "SMV_STAGE_TOUR_READY", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "type": "USER_LIST_UPLOAD", "sourcePlatform": "LIST_UPLOAD", "destinations": [{"destination": "LINKEDIN"}]}

Journey mover — batch ADD / REMOVE (SHA256_EMAIL)

Emails are lowercased, trimmed, SHA-256 hashed in-browser before they ever leave this page. LIST_UPLOAD segments cannot be edited by streaming — use USER-type segments for stage tags.
Floors: 300 matched members to serve. Engagement segments take ≤48h to populate + up to 24h to start delivering. Unused segments auto-archive after 30 days out of any draft/active campaign.
S-06 · Measure
Reporting — adAnalytics
Builds the exact GET /rest/adAnalytics finder. Only impressions + clicks return by default — the fields param is mandatory (≤ 20 metrics). Demo mode charts 30 days of generated data.

Query builder

MEMBER_* pivots: values with fewer than 3 events are suppressed; approximateMemberReach unavailable; up to 24h lag. VCR is computed client-side = videoCompletions / videoStarts.

Impressions · 30d (demo)

30d total
586,899
peak day
19,904

Spend by campaign · 30d (demo)

SMV|G|00-UNAWARE|VID$7,058
SMV|E|00-UNAWARE|VID$5,587
SMV|D|00-UNAWARE|VID$4,885
SMV|G|03-PRODUCT|VID$4,243
SMV|G|01-PROBLEM|VID$4,145
SMV|F|03-PRODUCT|VID$3,911
SMV|C|00-UNAWARE|VID$3,845
SMV|E|03-PRODUCT|VID$3,588

Campaign table (demo)

campaignimprclicksctrspendvcrleadsfreq risk
SMV|A|00-UNAWARE|VID37,8002440.65%$2,07931.0%0refresh soon
SMV|A|01-PROBLEM|VID22,1821470.66%$1,35331.0%0refresh soon
SMV|A|03-PRODUCT|VID22,3541450.65%$1,49831.0%0refresh soon
SMV|A|04-CONVERSION|LGF11,136740.66%$813—11ok
SMV|B|00-UNAWARE|VID38,0422510.66%$3,00531.0%0refresh soon
SMV|B|01-PROBLEM|VID21,6181450.67%$1,83831.0%0refresh soon
SMV|B|03-PRODUCT|VID21,3611400.66%$1,94431.0%0refresh soon
SMV|B|04-CONVERSION|LGF10,671700.66%$1,035—8ok
SMV|C|00-UNAWARE|VID37,3322460.66%$3,84531.0%0refresh soon
SMV|C|01-PROBLEM|VID21,9271430.65%$2,39031.0%0refresh soon
SMV|C|03-PRODUCT|VID22,2431440.65%$2,55831.0%0refresh soon
SMV|C|04-CONVERSION|LGF11,179740.66%$1,353—9ok
SMV|D|00-UNAWARE|VID38,4632490.65%$4,88531.0%0refresh soon
SMV|D|01-PROBLEM|VID21,8971450.66%$2,91231.0%0refresh soon
SMV|D|03-PRODUCT|VID21,5431430.66%$2,99431.0%0refresh soon
SMV|D|04-CONVERSION|LGF10,668680.64%$1,547—8ok
SMV|E|00-UNAWARE|VID37,0012410.65%$5,58731.0%0refresh soon
SMV|E|01-PROBLEM|VID21,6481430.66%$3,39931.1%0refresh soon
SMV|E|03-PRODUCT|VID22,0111410.64%$3,58831.0%0refresh soon
SMV|E|04-CONVERSION|LGF11,145720.65%$1,884—10ok
SMV|F|03-PRODUCT|VID22,3501500.67%$3,91131.0%0refresh soon
SMV|F|04-CONVERSION|LGF11,078710.64%$2,005—8ok
SMV|G|00-UNAWARE|VID37,7422430.64%$7,05831.0%0refresh soon
SMV|G|01-PROBLEM|VID21,4751430.67%$4,14531.0%0refresh soon
SMV|G|03-PRODUCT|VID21,3221390.65%$4,24331.0%0refresh soon
SMV|G|04-CONVERSION|LGF10,711720.67%$2,196—11ok
S-07 · Measure
Conversions, Insight Tag, UTM
Conversion rules (Insight Tag or CAPI), li_fat_id capture, and a deterministic UTM taxonomy that reconciles LinkedIn ↔ GA4 on utm_id.

Conversion rules — /rest/conversions

SMV Tour Request (LEAD)LEAD · CONVERSIONS_API
{"name": "SMV Tour Request (LEAD)", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "conversionMethod": "CONVERSIONS_API", "type": "LEAD", "attributionType": "LAST_TOUCH_BY_CAMPAIGN", "postClickAttributionWindowSize": 90, "viewThroughAttributionWindowSize": 7, "enabled": true}
LEAD supports up to a 365-day post-click window — use it: CRE cycles outlive 90 days.
SMV Suite Page View (KEY_PAGE_VIEW)KEY_PAGE_VIEW · PIXEL
{"name": "SMV Suite Page View (KEY_PAGE_VIEW)", "account": "urn:li:sponsoredAccount:{AD_ACCOUNT_ID}", "conversionMethod": "PIXEL", "type": "KEY_PAGE_VIEW", "attributionType": "LAST_TOUCH_BY_CAMPAIGN", "postClickAttributionWindowSize": 30, "viewThroughAttributionWindowSize": 7, "enabled": true}
LEAD supports up to a 365-day post-click window — use it: CRE cycles outlive 90 days.

Insight Tag + li_fat_id capture

<script type="text/javascript"> _linkedin_partner_id = "{PARTNER_ID}"; window._linkedin_data_partner_ids = window._linkedin_data_partner_ids || []; window._linkedin_data_partner_ids.push(_linkedin_partner_id); </script> <script src="https://snap.licdn.com/li.lms-analytics/insight.min.js" async></script> <!-- li_fat_id capture: store the click id for later CAPI upload --> <script> (function(){var m=location.search.match(/li_fat_id=([^&]+)/); if(m){try{localStorage.setItem("li_fat_id",m[1]);document.cookie="li_fat_id="+m[1]+";max-age=7776000;path=/"}catch(e){}}})(); </script>
Enable enhanced conversion tracking in Campaign Manager so LinkedIn appends ?li_fat_id= to your landing URLs; the snippet stores it for the CAPI call when the lease inquiry closes weeks later.

UTM builder

https://SITE/smithville/suite-600?utm_source=linkedin&utm_medium=paid-social&utm_campaign=smv_a_00&utm_content=dentist-suite600-v1&utm_id=smv_a_00_dentist-suite600-v1 GA4: session_campaign_id = utm_id = smv_a_00_dentist-suite600-v1 Join key back to this OS: campaign A/00 · creative variant dentist-suite600-v1

CAPI — server-side conversion event

Includes eventId for dedup against the Insight Tag; conversionHappenedAt must be within 90 days. Include currency+amount — events missing them can be dropped on some paths.
S-08 · Measure
Contacts
The index. Open a prospect for the full record: context, verified contact points, mapped LinkedIn profile, portfolio, family & connections, generated bio, and the next best action.
prospectcompany / titletagsverifiedscoreprofilestatus
Dana R.
dana@example-dental.com
Example Dental Group
Practice Owner
A04Owner-Occupant2 sig3/63 scraped3563%
Marcus T.
marcus@example-fit.com
Example Fitness Dev LLC
Area Developer
C030/1257%
Priya S.
priya@example-cre.com
Example Brokerage
Tenant Rep
F030/1307%
Alex R.
alex@example-dental.com
Example Dental Group
Managing Partner / COO
A030/1157%
Score ≥ 25 = route to broker within 1 business hour. Verify contact points before routing — scraped data never goes to a broker unconfirmed.
S-09 · Plan
Calendar & Scheduler
Scheduled launches, fatigue checks, report pulls, and audience gates. A static page can’t fire while closed — items come due on open, and Run executes the linked API action. Refresh cadence: cold creative every 2–4 weeks; pause anything with frequency > 3.5/week and CTR down 15% from its 7-day baseline.
datetypeactionstatus
2026-07-21LAUNCHLaunch Document Ad (flyer) — Segment Fdue
2026-07-21LAUNCHPublish + sponsor Thought Leader posts (Danner, Nelson)due
2026-07-28LAUNCHLaunch Single Image ads (A/B/C/E/F variants)scheduled
2026-08-04LAUNCHUnaware videos live (A–G) — start audience buildscheduled
2026-08-11REFRESHCreative fatigue check — pause any frequency>3.5 & CTR −15%scheduled
2026-08-18REPORTPull adAnalytics CREATIVE pivot — weekly reportscheduled
2026-08-18AUDIENCEStage 01 activation — verify 50% VCR segments ≥300 membersscheduled

Cadence rules baked into this plan

Week 1: Document Ad (F) + Thought Leader Ads live · Week 2: Single Image variants · Week 3: Unaware videos, audience build starts · Week 4+: stage 01–03 activate as each engagement segment clears 300 members · every 14 days: adAnalytics CREATIVE pivot review · every 21–28 days: creative refresh or rotation.
S-10 · Plan
Competitor Intel — Gallery, Analysis, Counter-Strategy
LinkedIn’s Ad Library has no official API and hides US targeting detail — capture is manual or via a third-party scraper feeding this schema. Cards marked ARCHETYPE are illustrative reconstructions of the recurring patterns in CRE/franchise advertising (fictionalized advertisers); replace them with SCRAPED captures as you collect the real thing.
Ad Library: CRE + Kansas CityAd Library: retail space for leaseAd Library: medical office spaceAd Library: franchise MO
M
Meridian Brokerage Group
Institutional brokerage · Promoted
Now leasing: 24,500 SF neighborhood retail center in the Northland. Join national co-tenants in a growing trade area. Contact our retail team today.
NOW LEASING
[photo: drone aerial of center]
Retail Space Available | Northland Kansas City
LEARN MORE
ARCHETYPESINGLE_IMAGEG / 03
Inferred targeting:Industry: Real Estate + Retail · broad KC DMA · likely job function Business Development/Owner, no seniority floor
+ Brand trust of a big shop · Co-tenancy name-drop
− Zero numbers — no SF menu, no demographics · Brochure voice ("growing trade area") · Lands on a generic listings page
Counter:Out-specify them: suite-by-suite SF, 5.5-mi income, delivery year in the first line.
N
NorthPoint Districts
Developer (lifestyle center) · Promoted
A new kind of gathering place is coming to the Northland. Retail, dining, and community — opening 2027. Reserve your space early.
COMING 2027
[6 cards: architectural renderings]
The Future of Northland Retail | Coming 2027
VISIT WEBSITE
ARCHETYPECAROUSELG / 02
Inferred targeting:Retail + Restaurants industries · Owners/Founders · KC metro · retargets site visitors
+ Beautiful renderings · Carousel = multiple concepts shown
− Renderings ≠ proof — nothing is built · 2027 horizon loses 2026 tenants · No committed tenants named
Counter:Proof beats promise: real construction photos, 5 committed tenants named, delivering 2026 — a year earlier.
P
PracticeSite Advisors
Medical RE specialist (national) · Promoted
Your practice deserves a home that works as hard as you do. Download our free guide: 7 mistakes practice owners make when leasing medical space.
7 MISTAKES
[photo: dentist with patient, stock]
The Practice Owner’s Guide to Medical Real Estate
DOWNLOAD
ARCHETYPESINGLE_IMAGEA / 02
Inferred targeting:Job function: Healthcare Services · seniority Owner/Partner · national, no geo focus
+ Speaks the segment’s language · Gated guide captures leads at 02
− Pure emotion, zero market data · National generic — no corridor, no site · Stock photography
Counter:Same audience, but armed: "26,609 people. One medical corridor gap." KC-specific numbers they can’t copy.
C
Crave Franchise Brands
QSR franchisor (recruiting) · Promoted
KC territories are open. Multi-unit operators are building generational wealth with Crave. 15-second story of our newest franchisee.
▶ 0:15
[video: franchisee testimonial]
Own the Next Great Burger Franchise | KC Territories Open
APPLY NOW
ARCHETYPESINGLE_VIDEOB / 01
Inferred targeting:Skills: Franchising, Multi-Unit Management · interests small business ownership · MO/KS geos
+ Intent-rich audience — people actively buying a franchise · Video testimonial social proof
− Sells the brand, never the site — real estate is the buyer’s next problem · No geography inside KC
Counter:Piggyback the timing: they create franchisees, we place them. "You picked the brand. Now the corner: U.S. 169."
F
FlexDesk KC
Coworking / flex operator · Promoted
Private offices from $299/mo. Furnished, wired, coffee’s on. Tour today, move in Monday.
$299/MO
[photo: furnished glass office]
Private Offices from $299/mo | Move In Monday
BOOK TOUR
ARCHETYPESINGLE_IMAGEE / 03
Inferred targeting:Company size 1–10 · consultants/attorneys/CPAs by function · tight KC radius
+ Price transparency wins clicks · Immediacy ("move in Monday")
− Shared identity — their sign, not yours · Month-to-month churn positioning · Price-led race to the bottom
Counter:Don’t fight the price — fight the identity: "Your name on the door. Your address on the letterhead." Permanence vs desk rental.
T
TenantFirst Advisory
Tenant-rep brokerage · Promoted
Landlords have brokers. So should you. Our Q3 Northland retail market report — vacancy, absorption, and where the deals are — free inside.
Q3 REPORT
[document: 12-page PDF preview]
Q3 Northland Retail Market Report | TenantFirst
DOWNLOAD
ARCHETYPEDOCUMENTF / 02
Inferred targeting:Business owners + office managers broadly · KC metro · excludes RE industry
+ Document format — rare and high-engagement · Positions as the tenant’s ally
− Competes for the same tenants’ attention — but is not actually a rival
Counter:This is an amplifier, not an enemy: court them. Co-brokerage welcome, full package (Segment F), fee clarity. Their clients become our LOIs.
S
Summit Pad Sites
Pad-site developer · Promoted
Hard-corner pad sites on a 34,000 VPD corridor. Drive-thru approved. QSR and bank users welcome.
34,000 VPD
[photo: intersection aerial with lot lines]
Pad Sites Available | 34,000 VPD Corridor
LEARN MORE
ARCHETYPESINGLE_IMAGEB / 03
Inferred targeting:Industries: Restaurants, Banking · site selectors + franchise development titles · regional
+ Traffic count as the hook — numbers work · "Drive-thru approved" removes a diligence step
− Unverified VPD claims are the norm — and a liability · Bare-land timeline vs built space
Counter:We hold traffic counts until MoDOT verifies — and say so. Trust as positioning: every number on our ads has a source line.
I
IronWorks Fitness Franchising
Boutique fitness franchisor · Promoted
6 Missouri territories sold this quarter. IronWorks owners average breakeven in month 9. Your market is waiting.
6 SOLD
[5 cards: gyms + unit economics]
IronWorks Franchise | Missouri Territories Going Fast
REQUEST INFO
ARCHETYPECAROUSELC / 01
Inferred targeting:Skills: Fitness, Entrepreneurship · age 30–55 proxy via seniority · MO statewide
+ Urgency + social proof ("6 sold") · Unit-economics carousel card
− Every sold territory now needs a 8–12K SF box — their success is our pipeline · No real estate answer offered
Counter:"Territory secured? The box is next." 10,000 SF standalone, parking field, anchor traffic — aimed at their new signees.
C
Competitor A — KC CRE brokerage (example)
Captured · Promoted
Now leasing — 2,400 SF retail on 152 Hwy…
SINGLE_IMAGE
[captured — no media stored]
Retail Space | Liberty MO
LEARN MORE
SCRAPEDSINGLE_IMAGEG / 03

Capture a scraped ad

Pattern read (9 ads)

SINGLE_IMAGE ×5CAROUSEL ×2SINGLE_VIDEO ×1DOCUMENT ×1
03 ×402 ×301 ×2
LEARN_MORE ×3DOWNLOAD ×2VISIT_WEBSITE ×1APPLY_NOW ×1BOOK_TOUR ×1REQUEST_INFO ×1
G ×3B ×2A ×1E ×1F ×1C ×1

Whitespace — computed

Formats they barely touch:DOCUMENT, CONVERSATION, THOUGHT_LEADER — our document package and conversation ads run nearly uncontested (2.68% vs 0.42% benchmark CTR for member-voice formats).
Stages left open:00 — everyone fights at 03/04 where CPMs peak; 00–02 education is cheap attention.
Segments with zero competitor presence:D.
Messaging read:the field splits into adjective ads (institutional/developer) and one-number ads (price, VPD, territories sold). Nobody stacks sourced demographics + suite menu + delivery year in one frame — that stack is the differentiator.

Counter-strategy — messaging & targeting by segment

segtheir patternour counter-messagetargeting counter
A
Medical / Dental / Urgent Care
National medical-RE specialists sell emotion + gated guides; institutionals ignore sub-specialty entirely."26,609 people within 5.5 miles. Average HHI $120,991. Zero endodontists." — corridor-gap math they can’t copy-paste.Function: Healthcare Services + seniority Owner/Partner, KC metro (never title-narrow — sub-300 floor). Sub-specialty lives in the copy, not the audience.
B
Franchise QSR & Coffee Developers
Franchisors recruit operators with brand ads; pad developers pitch unverified traffic counts.Piggyback the franchisor’s funnel: "You picked the brand. Now the corner." Every number sourced — trust vs their VPD hand-waving.Skills/groups: Franchising, Multi-Unit Management + industry Restaurants, MO/KS. Retarget video viewers of stage 01.
C
Fitness Franchisees & Area Developers
Fitness franchisors sell territories ("6 sold this quarter") and leave every new signee hunting for a box."Territory secured? The box is next." Their sales pipeline is our prospect list.Skills: Fitness + Entrepreneurship, MO. Sequence directly behind franchisor ad flights (their spend warms our audience).
D
Regional Restaurant Groups
Institutional listings treat restaurant groups like any tenant — generic space ads, no operator math.Second-unit math: the 5,180 SF suite framed as expansion economics, not square footage.Industry: Restaurants + seniority Owner/Director, KC metro. Warm: engagers of D-stage video.
E
Professional Services
Coworking wins on price transparency ("$299/mo") and immediacy — a race we should not enter.Fight identity, not price: "Your name on the door." Permanence + professional address vs desk rental. Stay honest: rates on request — and we respond same-day.Company size 1–10 + functions Legal/Accounting/Consulting, tight 10-mi radius. Their weakness (churn) is our retargeting window.
F
Tenant-Rep Brokers & Site Selectors
Tenant-rep shops run the only document ads in the space — and they’re courting the exact tenants we want.They’re amplifiers, not rivals: co-brokerage welcome, full package, fee clarity, fast callbacks. Make Smithville the easiest check on their survey.Industry: Real Estate + Leasing/Brokerage functions, KC metro — compressed 02→03→04 funnel (they already know the market).
G
Retail / Specialty (Pet, Vet, Liquor)
Developers sell 2027 renderings; institutionals sell brochure adjectives. Nobody shows proof.Proof beats promise: construction photos, 5 committed tenants named, 2026 delivery — a year ahead of the renderings.Industries: Retail + Consumer Services, Owners, KC metro. Retarget carousel engagers.

Coverage gap — them vs you

segment0001020304
Ayouyouyoucompyouyou
Byouyoucompyouyoucompyou
Cyouyoucompyouyouyou
Dyouyouyouyouyou
Eyouyouyouyoucompyou
F——youcompyouyou
Gyouyouyoucompyoucompyou
Green = your campaign exists. Red = competitor presence (gallery). Red-without-green cells need an answer; green-only cells are uncontested ground — defend the cheap ones (00–02) before CPMs follow the crowd.
Strategy synthesis: (1) never enter the price war — coworking owns it and we can’t publish rates; (2) own the sourced-number frame — demographics + suite menu + 2026 in every unit of copy; (3) buy the empty early stages 00–02 where competitor CPM pressure is absent; (4) run the formats they skip (document, conversation, TLA); (5) treat tenant-rep and franchisor ads as pipeline, not competition — sequence behind their spend.
S-11 · System
Connection
Everything runs in demo mode until this is filled in. api.linkedin.com does not send CORS headers, so a browser page cannot call it directly — route Live mode through a small proxy you control, or copy cURL from any button and run it server-side.

Credentials

OAuth scopes this OS uses

r_ads — read campaigns
rw_ads — create/patch campaigns + creatives
r_ads_reporting — adAnalytics
rw_dmp_segments — audiences (separate program approval)
rw_conversions — conversion rules + CAPI
r_marketing_leadgen_automation — lead sync (separate program)
w_organization_social — organic posts

Advertising API, Audiences, and Lead Sync are separate LinkedIn program approvals — apply early.

Cloudflare Worker proxy (copy, deploy, paste its URL above)

export default {async fetch(req) {const url = new URL(req.url); const target = "https://api.linkedin.com" + url.pathname + url.search; const h = new Headers(req.headers); h.delete("host"); const resp = await fetch(target, { method: req.method, headers: h, body: req.method === "GET" ? undefined : req.body }); const out = new Headers(resp.headers); out.set("Access-Control-Allow-Origin", "*"); out.set("Access-Control-Allow-Headers", "*"); out.set("Access-Control-Allow-Methods", "*"); out.set("Access-Control-Expose-Headers", "x-restli-id"); if (req.method === "OPTIONS") return new Response(null, { headers: out }); return new Response(resp.body, { status: resp.status, headers: out });}};
Lock the worker down before production: restrict allowed origins to your own domain and keep the token out of client storage if others can open this file. localStorage on a shared machine is readable.
S-12 · System
API Console
Every request this OS builds, newest first — payload, headers, response or block reason, and a copyable cURL. BLOCKED means unresolved {tokens}; NETWORK_FAIL in live mode almost always means CORS (use the proxy).
6:06:05 PM · AUTOPILOT · Weekly audience floor check · SEG A coldBLOCKED
GET https://api.linkedin.com/rest/adAccounts/{AD_ACCOUNT_ID}/audienceCounts?q=targetingCriteriaV2{"Authorization": "Bearer {ACCESS_TOKEN}", "LinkedIn-Version": "202606", "X-Restli-Protocol-Version": "2.0.0"}
{"error": "Unresolved tokens — resolve URNs/IDs before sending", "tokens": [ "{AD_ACCOUNT_ID}" ]}